Datavant Ireland logo

Software Engineer

Datavant Ireland
Department:Software Engineer
Type:HYBRID
Region:Galway
Location:Galway, County Galway, Ireland
Experience:Mid-Senior level
Estimated Salary:€60,000 - €90,000
Skills:
PYTHONJAVASCRIPTTYPESCRIPTREACTSQLAWSKUBERNETESTERRAFORMSNOWFLAKEAPACHE SPARK
Share this job:

Job Description

Posted on: December 13, 2025

Datavant is a data platform company and the world’s leader in health data exchange. Our vision is that every healthcare decision is powered by the right data, at the right time, in the right format. Our platform is powered by the largest, most diverse health data network in the U.S., enabling data to be secure, accessible and usable to inform better health decisions. Datavant is trusted by the world’s leading life sciences companies, government agencies, and those who deliver and pay for care. By joining Datavant today, you’re stepping onto a high-performing, values-driven team. Together, we’re rising to the challenge of tackling some of healthcare’s most complex problems with technology-forward solutions. Datavanters bring a diversity of professional, educational and life experiences to realize our bold vision for healthcare. What We're Looking For At Datavant we value Engineers who problem solve, build, and understand the methodologies and underlying concepts of software engineering. As a Software Engineer you will be a major factor in growing our healthcare data ecosystem solution for our clients. Don’t know our tech stack well? We view technology as a means to solving problems and getting things done, we value talent over current tech stack. You will provide hands-on resources who can work on the architect and design level while helping other team members. You will start meaningful work from day one and will be in a stretch role that can propel your career to higher levels. What You Need To Succeed

  • 5+ years of hands-on engineering experience delivering production-ready code, conducting thoughtful code reviews, and contributing to full-stack application architecture and design.
  • Proficiency in modern programming languages, especially Python and JavaScript/TypeScript (including React), with a focus on writing clean, maintainable, and scalable code.
  • Strong command of SQL and relational databases, with the ability to model and query data effectively.
  • Experience designing and building scalable data pipelines and flows for high-volume systems.
  • A collaborative mindset. You are energized by fast-paced environments, proactive communication, and working closely with cross-functional teams.
  • A track record of ownership. You have led projects, driven migrations, and consistently shipped impactful features.
  • Educational background in Computer Science, Information Technology, or a related field is a plus.

While not required, familiarity with the following tools and domains will give you a strong edge:

  • Cloud & Infrastructure: AWS, AWS Marketplace, Kubernetes, Helm, Terraform, GitHub Actions
  • Data & Analytics: Snowflake, Databricks, Apache Spark, Polars
  • Web & Backend: Flask, scalable API development
  • Platforms: Building and deploying software on Windows, Mac, and Linux
  • Domain Experience: Data Analytics, Business Intelligence, or the Healthcare space, especially around healthcare data, HIPAA, and data privacy.

What You Will Do

  • Build and deliver impactful products. Play a key role in the design, implementation, and end-to-end development of critical applications that power our health data ecosystem.
  • Lead by example. Guide and mentor fellow engineers while solving complex problems and driving technical excellence across the team.
  • Own your work. Take full ownership of major projects. With minimal bureaucracy and high trust, you’ll have the autonomy to make meaningful decisions and move fast.
  • Innovate for impact. Develop high-value data solutions that help our clients unlock better insights and outcomes from health data.
  • Work with modern tools. Leverage a cutting-edge tech stack including Python, JavaScript/TypeScript, React, Spark, Snowflake, AWS, Azure, and more.
  • Share your knowledge. Contribute to our engineering blog and help us grow our voice in the tech community.

Join Our Team at Datavant Ireland – A Galway-Based R&D Technology Center Datavant Ireland is an innovative R&D technology center based in Galway, dedicated to solving complex technology challenges with a purpose. We are looking for talented technical professionals who are product-minded and eager to make an impact. If you are passionate about developing cutting-edge solutions and want to be part of a growing team, we invite you to explore the exciting career opportunities at Datavant. Careers at Datavant offer the opportunity to apply your technology and problem-solving skills toward a vision that every healthcare decision is powered by the right data, at the right time, in the right format. We’re looking for problem-solvers, game-changers, innovators, dreamers, doers—people who are ready to move the needle and build on our success. We provide team members with a robust total compensation package that includes:

  • Competitive, equitable salary.
  • Comprehensive benefits.
  • Pension contribution.
  • Flexible, Hybrid work environment.

We are committed to building a diverse team of Datavanters who are all responsible for stewarding a high-performance culture in which all Datavanters belong and thrive. We are proud to be an Equal Employment Opportunity employer. Datavant is committed to working with and providing reasonable accommodations to individuals with physical and mental disabilities. If you need an accommodation while seeking employment, please request it here, by selecting the ‘Interview Accommodation Request’ category. You will need your requisition ID when submitting your request, you can find instructions for locating it here. Requests for reasonable accommodations will be reviewed on a case-by-case basis. For more information about how we collect and use your data, please review our Privacy Policy.

Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

Datavant Ireland logo

Datavant Ireland

View company page
IrelandJobs.app - Find your dream job in Ireland logo

IrelandJobs.app - Find your dream job in Ireland

Get IrelandJobs.app - Find your dream job in Ireland on your phone!

SIMILAR JOBS
Datavant Ireland logo

Senior Software Engineer

Datavant Ireland
Just now
Software Engineer
HYBRID
Galway, County Galway, Ireland
PYTHONJAVASCRIPTTYPESCRIPT+12 more
Datavant Ireland logo

Software Engineer

Datavant Ireland
Just now
Software Engineer
HYBRID
Galway, County Galway, Ireland
PYTHONJAVASCRIPTTYPESCRIPT+7 more
Genesys logo

Fullstack Software Engineer

Genesys
Just now
Software Engineer
HYBRID
Galway, County Galway, Ireland
PYTHONJAVAJAVASCRIPT+9 more
Recruitment by Aphex logo

CSV Engineer

Recruitment by Aphex
2 days ago
Software Engineer
ON-SITE
Tipperary, County Tipperary, Ireland
COMPUTER SYSTEM VALIDATIONGAMP5EMERSON DELTAV+15 more
Eli Lilly and Company logo

Building Management System (BMS) Automation Engineer

Eli Lilly and Company
2 days ago
Software Engineer
ON-SITE
Limerick, County Limerick, Ireland
SIEMENS DESIGO CCPLC/HMI CONFIGURATIONS7 1500S+38 more