Klaviyo logo

AI Engineering Manager - Amplify C.S

Klaviyo
Department:Business Development
Type:HYBRID
Region:Dublin
Location:Dublin, County Dublin, Ireland
Experience:Mid-Senior level
Salary:€112,000 - €168,000
Skills:
PYTHONREACTDJANGOFASTAPITYPESCRIPTMYSQLREDISMEMCACHEDRABBITMQCELERYAPACHE KAFKAAPACHE PULSARAWSTERRAFORMKUBERNETESOPENAIANTHROPICGEMININ8N
Share this job:

Job Description

Posted on: May 5, 2026

At Klaviyo, we value the unique backgrounds, experiences and perspectives each Klaviyo (we call ourselves Klaviyos) brings to our workplace each and every day. We believe everyone deserves a fair shot at success and appreciate the experiences each person brings beyond the traditional job requirements. If you’re a close but not exact match with the description, we hope you’ll still consider applying. Want to learn more about life at Klaviyo? Visit klaviyo.com/careers to see how we empower creators to own their own destiny. Team Overview The Amplify Engineering team builds internal tools, platforms, and AI-powered automation that help Klaviyos work more efficiently and at scale as the company grows. We partner across the organisation, including Sales, Marketing, Engineering & Product, Customer Service & Success, and Finance, to solve real operational problems with practical, well-designed software. Our work spans internal applications, 3rd-party integrations, interactive dashboards, CMS integrations, and robust AI systems and agents that automate repetitive tasks, surface the right information at the right time, and help teams make better decisions. We operate in tight feedback loops with our internal customers, shipping quickly, learning fast, and seeing the impact of our work immediately in how deals move faster, tickets resolve sooner, and launches go more smoothly. This role is for builders and leaders who enjoy turning real-world pain points into reliable, scalable solutions. The work is highly visible and deeply impactful, shaping how thousands of Klaviyos get their work done every day through fast iteration, high ownership, and clear outcomes. How You’ll Make An Impact The Amplify team builds the internal platforms, automation, and AI-driven systems that power how Klaviyos work every day. As an Engineering Manager, you will:

  • Lead one or more engineering teams and help shape the technical direction for internal tools and platforms that improve efficiency, automation, and productivity.
  • Lead a portfolio of internal systems supporting Sales, Marketing, Customer Service & Success, R&D, and Finance, including AI-powered workflows, internal web applications, data and event pipelines, third-party integrations, and support tooling.
  • Balance technical leadership and people leadership, setting direction, modelling best practices, and enabling teams to deliver effectively through others.
  • Partner closely with engineers, product managers, designers, and senior stakeholders to translate organisational challenges into scalable, high-quality software solutions.
  • Learn and evolve Klaviyo’s end-to-end internal workflows, scaling platforms and processes to support the company’s next phase of growth.
  • Foster a culture of collaboration, systems thinking, technical excellence, and curiosity around new technologies, including AI.
  • Make a direct and visible impact on how thousands of Klaviyos get their work done every day.

Who You Are

  • You are passionate about building software for the long term, balancing technical quality, delivery pace, and business impact.
  • BA or BS Degree in Computer Science, related field, or equivalent experience.
  • You have 5+ years of hands-on software development experience building and operating highly available, full-stack SaaS products, with a solid understanding of modern web architectures and scalable, multi-tenant systems.
  • You have 3+ years of experience as an engineering manager, leading high-performing teams that deliver complex, cross-team initiatives using an agile, iterative approach.
  • You are a technically curious leader with hands-on experience using modern AI tools and workflows (e.g. OpenAI, Anthropic, Gemini, n8n) and an interest in helping teams apply them thoughtfully to improve productivity and outcomes.
  • You are comfortable setting technical direction and standards, working with peers and senior leadership to evolve architecture, development practices, and shared engineering processes.
  • You have experience owning work end-to-end – from design through delivery and deployment, including planning, estimation, and managing delivery risks.
  • You are an effective cross-functional communicator, able to work closely with product, design, and business partners to align priorities and move work forward.
  • You are a people-first leader who enjoys hiring, onboarding, mentoring, and developing engineers, creating an environment where individuals and teams can grow and do their best work.
  • You enjoy leading teams that build internal platforms, tools, or systems that improve productivity, automation, and operational efficiency across an organisation.
  • You like to question convention, continuously improve how work gets done, and thrive in small, autonomous teams that ship early and often in close partnership with their stakeholders.

Nice To Have

  • Experience building internal tools, platforms, or automation for developers and/or non-technical teams.
  • Hands-on experience in full-stack environments, including diagnosing and improving application performance.
  • Strong practical experience using AI tools and patterns (e.g. APIs/SDKs, prompt and context design, automated or agentic workflows, RAG, and evaluation or monitoring).
  • Experience working with cloud infrastructure (AWS preferred), including infrastructure-as-code and containerised environments (Terraform and Kubernetes). Familiarity with GCP or Azure is a plus.

30 / 60 / 90 / 6-12 Month Plan30 Days: Build context across the Amplify domain by learning the teams’ areas of ownership, architecture, and core workflows. Establish trust with engineers and partners while contributing to technical discussions and trade-off decisions. 60 Days: Assess team roadmaps and delivery practices, incorporating input from engineers and stakeholders. Align priorities with the technical direction and business goals you are helping to shape, and begin contributing to hiring and team growth. 90 Days: Improve how teams and stakeholders work by introducing or refining tools, processes, or architectural approaches. Provide technical leadership through reviews, guidance, and targeted hands-on contributions where helpful. 6-12 months: Be a trusted owner of your teams’ platforms and systems, known for delivering meaningful, scalable impact. Partner closely with product and design to drive adoption of Amplify systems and evolve them to support Klaviyo’s continued growth. Technologies We Use Klaviyo’s platform is primarily built with Python and React and runs on AWS. New hires join us from a wide range of technical backgrounds and are supported in learning our stack. Core technologies include:

  • Python / Django / FastAPI
  • Typescript / React
  • MySQL / Redis / Memcached
  • RabbitMQ / Celery / Apache Kafka / Apache Pulsar
  • AWS / Terraform / Kubernetes

Location & Work Model This role is based in Dublin, Ireland, and follows a hybrid working model. Klaviyo supports work authorization and relocation for this position. At Klaviyo, we enjoy tackling meaningful engineering challenges and value people who take ownership, learn continuously, and collaborate openly. We are committed to building inclusive teams and encourage applications from candidates of all backgrounds. Klaviyo is growing fast and we have openings for all skill levels across all of our teams. Learn more about our engineering culture at https://klaviyo.tech We use Covey as part of our hiring and / or promotional process. For jobs or candidates in NYC, certain features may qualify it as an AEDT. As part of the evaluation process we provide Covey with job requirements and candidate submitted applications. We began using Covey Scout for Inbound on April 3, 2025. Please see the independent bias audit report covering our use of Covey here #indeedDUB Our salary range reflects the cost of labour in the country where the job post is advertised. The base salary offered for this position is determined by several factors, including the applicant’s job-related skills, relevant experience, education or training, and work location. In addition to base salary, our total compensation package may include participation in the company’s annual cash bonus plan, variable compensation (OTE) for sales and customer success roles, equity, sign-on payments, and a comprehensive range of health, welfare, and wellbeing benefits based on eligibility. Your recruiter can provide more details about the specific salary/OTE range for your preferred location during the hiring process. Base Pay Range In Local Currency €112.000—€168.000 EUR This role may require up to 10% travel for purposes such as new hire onboarding, client or partner work if applicable, team meetings, and industry events. Travel is coordinated in advance. Get to Know Klaviyo We’re Klaviyo (pronounced clay-vee-oh). We empower creators to own their destiny by making first-party data accessible and actionable like never before. We see limitless potential for the technology we’re developing to nurture personalized experiences in ecommerce and beyond. To reach our goals, we need our own crew of remarkable creators—ambitious and collaborative teammates who stay focused on our north star: delighting our customers. If you’re ready to do the best work of your career, where you’ll be welcomed as your whole self from day one and supported with generous benefits, we hope you’ll join us. AI fluency at Klaviyo includes responsible use of AI (including privacy, security, bias awareness, and human-in-the-loop). We provide accommodations as needed. By participating in Klaviyo’s interview process, you acknowledge that you have read, understood, and will adhere to our Guidelines for using AI in the Klaviyo interview Process. For more information about how we process your personal data, see our Job Applicant Privacy Notice. Klaviyo is committed to a policy of equal opportunity and non-discrimination. We do not discriminate on the basis of race, ethnicity, citizenship, national origin, color, religion or religious creed, age, sex (including pregnancy), gender identity, sexual orientation, physical or mental disability, veteran or active military status, marital status, criminal record, genetics, retaliation, sexual harassment or any other characteristic protected by applicable law. IMPORTANT NOTICE: Our company takes the security and privacy of job applicants very seriously. We will never ask for payment, bank details, or personal financial information as part of the application process. All our legitimate job postings can be found on our official career site. Please be cautious of job offers that come from non-company email addresses (@klaviyo.com), instant messaging platforms, or unsolicited calls. By clicking "Submit Application" you consent to Klaviyo processing your Personal Data in accordance with our Job Applicant Privacy Notice. If you do not wish for Klaviyo to process your Personal Data, please do not submit an application. You can find our Job Applicant Privacy Notice here and here (FR).

Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

IrelandJobs.app - Find your dream job in Ireland logo

IrelandJobs.app - Find your dream job in Ireland

Get IrelandJobs.app - Find your dream job in Ireland on your phone!

SIMILAR JOBS
Amicus Search & Recruitment logo

R&D Tax Director

Amicus Search & Recruitment
Just now
Business Development
HYBRID
County Dublin, Ireland
R&D TAX RELIEFTAX LEGISLATIONFINANCIAL CALCULATIONS+3 more
Klaviyo logo

AI Engineering Manager - Amplify C.S

Klaviyo
Just now
Business Development
HYBRID
Dublin, County Dublin, Ireland
PYTHONREACTDJANGO+16 more
Amicus Search & Recruitment logo

Financial Controller

Amicus Search & Recruitment
Just now
Business Development
ON-SITE
Dublin, County Dublin, Ireland
FINANCIAL CONTROLACCOUNTINGINTERNAL CONTROL+5 more
Agoda logo

Senior Data Analyst, Partner Development - (Statistics/ML/BI) (Bangkok-based, relocation provided)

Agoda
Just now
Business Development
HYBRID
Dublin, County Dublin, Ireland
SQLPYTHONR+8 more
Auxilia Group Recruitment logo

Sales Account Manager - POS

Auxilia Group Recruitment
Just now
Business Development
ON-SITE
County Dublin, Ireland
BUSINESS DEVELOPMENTSALESRELATIONSHIP MANAGEMENT+3 more